PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.121070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 302aa    MW: 34393.7 Da    PI: 5.4913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.121070.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.4e-121459146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W  eEde l++ v+++G+++W++I ++  + Rt+k+c++rw +
   Cucsa.121070.1 14 KGPWKLEEDEVLLNHVNRFGPRDWSSIRSKGLLQRTGKSCRLRWVN 59
                     79*************************8887799**********87 PP

2Myb_DNA-binding47.54.2e-1570109344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++T+eE++  +++ +q+G++ W++Ia +++ gRt++++k++w
   Cucsa.121070.1  70 KFTAEEEKMVIELQAQFGNK-WAKIATYLP-GRTDNDVKNFW 109
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.463961IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-191062IPR009057Homeodomain-like
SMARTSM007174.5E-91363IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-2813109IPR009057Homeodomain-like
PfamPF002491.8E-101459IPR001005SANT/Myb domain
CDDcd001671.71E-91661No hitNo description
PROSITE profilePS5129420.08862117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-1963115IPR009057Homeodomain-like
SMARTSM007171.2E-1367115IPR001005SANT/Myb domain
CDDcd001671.54E-1170109No hitNo description
PfamPF002491.6E-1370109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEERRSQSHE VLRKGPWKLE EDEVLLNHVN RFGPRDWSSI RSKGLLQRTG KSCRLRWVNK  60
LRPNLKNGCK FTAEEEKMVI ELQAQFGNKW AKIATYLPGR TDNDVKNFWS SRQKRLARLL  120
QTSPAPSKLQ RSAKKEKPID FDIPSMEAPK LSSASEGESS LRPMSCLSSC CAENVEPLNM  180
FCSVPDPYSP KLLGFGQDFL QPEFNSIKFE QQSNFHTQSL SSTFSSQGLH DPNFDVFLET  240
LDVSQLTNEV QFPSGLQFYE PMECCSSHDV VRENVDNPES FFSEFPADIF ELEPLPSSPE  300
N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819251e-180LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132651e-180LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140627.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0A0KFL91e-171A0A0A0KFL9_CUCSA; Uncharacterized protein
STRINGVIT_15s0021g02040.t012e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-72MYB family protein